SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 150340.VEA_002776 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  150340.VEA_002776
Domain Number 1 Region: 450-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000451
Family Anti-sigma factor antagonist SpoIIaa 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 150340.VEA_002776
Sequence length 591
Comment (Vibrio Ex25)
Sequence
MVNPLAKILFAQWFPGLVQLKHYQKEWFVNDFRAAFSVVAVALPVAIAYAQLTGVSAIVG
LYSCVLPMLVYAMMGTSRQLIVGPDAATCAVIAAVVTPLAAGDPTKHWQLVMTMTAMTGI
WCVLASRFKLGVFADFLSRPILLGLLNGVALTIIVGQFAKVVGLKYEQRYLLERLWEAPQ
RLTELHWPTVTLSIVTVVVYLLTKRYRPTWPAAMLAILVTTASVWFFHLQEMGVSVVGLT
QGGFPQFQTPEFELGEVRELVVPALNLAIVSFVSMMLTARSFAAKNGYDIDANKEFQALG
FANIASAFSQGFAISGADSRTAVNDANGGKSQLVSIVAAITIAIIAVFIYEPLQFIPIAS
LGVVLIIASLSLLDLKAIWKLKSRDKDAFYLAIITFISVLIVGVIPGITLAVLLGLFQFL
RIVMRPSDQLLGLDEKGTIRTIDDSGKASPIPGMVIYRFNSPLTYFNAPYFKRRVLEQVE
HHKDASCVVIDAVSSFTHLDLSVMATLSDIHNTLKKRGVRLILAGRKRRLRQWCELTGIS
TSEGGILLRADMYLAIKLSGCYISAVGEGQIPTVQKEPDLEQPPKPIPEVA
Download sequence
Identical sequences A7K0I5
gi|262393549|ref|YP_003285403.1| 150340.VEA_002776 WP_006741676.1.43605 WP_006741676.1.82618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]