SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 150340.VEA_004029 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  150340.VEA_004029
Domain Number 1 Region: 106-321
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.67e-46
Family D-glucarate dehydratase-like 0.000000588
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.18e-25
Family Enolase N-terminal domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 150340.VEA_004029
Sequence length 329
Comment (Vibrio Ex25)
Sequence
MREAKIYRYSLPMDSGVILRDNKLTERAGYVVALSERDQIGLGEVAPLPGFSLENTEDAG
IQLQEQAERWVAGLDVDYANMYPSVAFGLSMAQLELAGGLPQQGKYQTAPLCTGDPDELI
PKLNEMEGEKVAKVKVGLYEPIRDGMLVNLFLESIPQLTLRLDANRAWTPEKAQQFAKYI
TPSLRQRITFLEEPCRSPGDSLSFAINTGIAIAWDETLQDAVRREDFRLEDLTGVKTIII
KPTLIGSVDFCITLIEKAKSLGMKAVISSSIESSLGLTQLARFAQWQLPDEVPGLDTIGL
FKAQLEQGWPKCELPVLPLKDQEIVWHSA
Download sequence
Identical sequences gi|262394800|ref|YP_003286654.1| WP_012842017.1.43605 WP_012842017.1.82618 150340.VEA_004029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]