SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 150340.VEA_004151 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  150340.VEA_004151
Domain Number 1 Region: 93-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000183
Family NfeD domain-like 0.0045
Further Details:      
 
Weak hits

Sequence:  150340.VEA_004151
Domain Number - Region: 27-88
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00102
Family Glycerol-3-phosphate transporter 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 150340.VEA_004151
Sequence length 153
Comment (Vibrio Ex25)
Sequence
MDFFSLLEGVSFWHWLAFGFALLAVELLGTAGYFLWLGVSALIVGALMTVLPMSWQLQWL
CFASFSLITTWLWWRRQWSKDKKEDQERDLNQKYKQLIGRTLTIEEDFSVGLNRIKVADT
TWSAQSDQALPAGTRVKIKDIDGIILIIEPDSK
Download sequence
Identical sequences A0A034U2D6
WP_012842052.1.43605 WP_012842052.1.82618 150340.VEA_004151 gi|262394920|ref|YP_003286774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]