SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 150340.VEA_004240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  150340.VEA_004240
Domain Number 1 Region: 32-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.6e-78
Family Phosphate binding protein-like 0.00000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 150340.VEA_004240
Sequence length 269
Comment (Vibrio Ex25)
Sequence
MKFSLKGLLTVATAASALVLAGCGDKEVDVNKVKVGVIAGAEAQVAEVAAKVAKEKYNLD
VELVTFTDYVTPNAALDDGSVDANAFQHKPYLDQQVKDRGYKLAIAGNSFVYPIAGYSKQ
VKSIDEIQDGARIAVPNDPTNLGRSLLLLEQQGLITLRDGVGLLATVRDIVGNPKNIEII
ELEAPQLPRSLDDVTLSIINTTYASSIDLSPERDGVFVEDKDSPYVNLIVAREENVNAQN
VQNFVKAYQTEEVYEAAKELFKGGVVKGW
Download sequence
Identical sequences A0A0N0CB99 A0A0T7EVK9 A0A2J6IR73 A7K614
gi|262395009|ref|YP_003286863.1| WP_005391357.1.10903 WP_005391357.1.18397 WP_005391357.1.3237 WP_005391357.1.36366 WP_005391357.1.43605 WP_005391357.1.75998 WP_005391357.1.82618 WP_005391357.1.98725 150340.VEA_004240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]