SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G02640.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G02640.1
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.36e-22
Family Cold shock DNA-binding domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 134-201
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000163
Family Retrovirus zinc finger-like domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G02640.1
Sequence length 203
Comment (Brachypodium distachyon)
Sequence
MAERVKGTVKWFNVEKGFGFISPEDGGEDLFVHQSSIKSDGFRSLDEGATVEFVVGSGDD
GRTKAIDVTGPGGVTLAGGSRGGGGDRYGGGGGGGRYGGGGGGGDRYGGGGGGGYGGGDR
YGGGGYGGGGGGYGGRSGGGGGRGCYTCGEEGHMARDCSQGGGGYGGGGGGYGGRGGGGG
GGRACYNCGEEGHISRECTNRAN
Download sequence
Identical sequences I1GL67
EG:BRADI1G02640.1 XP_003562975.1.954 15368.BRADI1G02640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]