SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G02650.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G02650.1
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-22
Family Cold shock DNA-binding domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 156-191
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000454
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 
Domain Number 3 Region: 119-149
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000785
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G02650.1
Sequence length 193
Comment (Brachypodium distachyon)
Sequence
MAERVKGTVKWFNVEKGFGFITPEDGGEDLFVHQSSIKSDGFRSLDEGATVEFVVGSGDD
GRTKAIDVTGPGGVTLAGGSRGGGGDRYGGGGGGGRYGGGGGDRYGGGGGGYGGGDRYGG
GGGGGGRGCYTCGEEGHMARDCNMARDCSQGGGGYGGGGGGYGGRGGGGGGGRACYNCGE
EGHISRECTNRAN
Download sequence
Identical sequences I1GL68
EG:BRADI1G02650.1 15368.BRADI1G02650.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]