SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G03740.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G03740.1
Domain Number 1 Region: 82-122
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000301
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 
Domain Number 2 Region: 42-80
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000711
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 
Domain Number 3 Region: 148-192
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000128
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 
Domain Number 4 Region: 5-42
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000297
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 
Weak hits

Sequence:  15368.BRADI1G03740.1
Domain Number - Region: 120-140
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000113
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G03740.1
Sequence length 201
Comment (Brachypodium distachyon)
Sequence
MEMDLSCKNCRRSGHFARDCPSASTCNNCNLPGHFAAECTSKTVCWNCKKSGHIATECTN
EALCHTCSKSGHLARDCPTSGSAKLCNNCFQPGHIAVDCTNDRACNNCRQSGHIARECTN
DPVCNLCNVSGHLARACPKTTLASEIHGGPFRDILCRMCGQPGHISRNCMATVICDTCGG
RGHMSYECPSARVFDRRLRRF
Download sequence
Identical sequences 15368.BRADI1G03740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]