SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G12460.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G12460.1
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-31
Family Canonical RBD 0.00065
Further Details:      
 
Domain Number 2 Region: 105-141
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000017
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G12460.1
Sequence length 314
Comment (Brachypodium distachyon)
Sequence
MAGKEESRIFVGGLSFHTDERKLEEAFRRFGKVVDAQIMLERHTNRHRGFGFVTFSDPRA
VESAISEMHTKELDGRTISVNRAEPKMNTDDTRYSSGGDRGADRGDYRGGKGDGPPPGNC
YQCGRAGHWARDCPNPAGGRSGQLSSKFSGGGGRGDRFSGSDRFSDRYMDDRYDGGRYGY
RDPIDNRDRYDGGRDRYASDRYPSGGDRFGADRYGGPDRYQPSGYGRERERSYERDAVRG
GAAFDRSGPRGGASYDRDGPRGGIGGGYDRDGPRGGGADNYVSGGPARYDGGSYRDRPGP
YDRPSRGGRYEDRF
Download sequence
Identical sequences I1GPK4
XP_003561336.1.954 EG:BRADI1G12460.1 15368.BRADI1G12460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]