SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G13180.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G13180.1
Domain Number 1 Region: 190-263
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000636
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 2 Region: 103-150
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000942
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G13180.1
Sequence length 627
Comment (Brachypodium distachyon)
Sequence
MVPQNVTVLVRRTAGQMSENIVLFSSRIVIEDGSVASNKSVITESASKSCSSTEVQDEDA
AIAAVIYAAELKWEEQSSKRGQGGGRFTSGRHYGHGPLEGEAPPPGYVCRSCGVPGHFIQ
HCPQENQKPPPGYTCFRCRIPGHFIQHCPTIGDLKFDNYNKVSRSLAPVVSANPVDGIPS
ALAPAASVSVVDDLPAELHCRLCNKVMADAVLTSKCCFDSFCDKCIRDYIITQSKCICGV
KVLADDLIPNHTLRSTISNLLATRTSSTTSGTGKHRSSSGSNPDPKSQSHITSTALERDM
KQCTDNQLSSASPDGGVQVATEDNKVSWAQENLDQKSKAEDSARCSVQKAVPSANALKLK
DVSESTLKNSTISGALEAKVARTDQLKKKRKKADSTKIVHSNNANYGYNVPFDPAYSNSG
YNVPFDPAYSNAFNSGYPWVTEPYMYGAMGMAYGGYPMGPFGANPFGNIPPQALAMQGYP
ASYQNWENHSALQREAETSARSRQIGMSKDSAPQPRPSEHSHRLASPLRRESRNRSPLNA
ESRSRSPHRRESRNRSRSRPERDHGRYDRDSNDYDEDHQSRKRIRLSSPMDDDKQSKRRS
RHSSSDDEQNFKRQWGRRSSVIMATRS
Download sequence
Identical sequences I1GPU1
15368.BRADI1G13180.1 EG:BRADI1G13180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]