SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G19910.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G19910.1
Domain Number 1 Region: 88-113
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000654
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 
Weak hits

Sequence:  15368.BRADI1G19910.1
Domain Number - Region: 118-166
Classification Level Classification E-value
Superfamily HAND domain of the nucleosome remodeling ATPase ISWI 0.00968
Family HAND domain of the nucleosome remodeling ATPase ISWI 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G19910.1
Sequence length 269
Comment (Brachypodium distachyon)
Sequence
MSGSDGKSQTAAGRIKAQAISAAKGLSRAQAERAAAAAARNVNAYGQKEEGPSRWQERKE
AKRQMYLESTEKAAVLGVKPKDVATSSGGAYSQCQNCFQLGHWTYECKNDRAYISRPSRS
QLLKNPKLKKTIVLESYRFVNPDLEKEREEERKLMKEKMEKEKSERGKGKSKRKYHSRRA
SDRNSSEASVFDSDTESSGTGSEYSSESGSSSCSSSDSEDEKRRYKRKQKKRRESTSSAS
SESESESESDSDSDDMGSRKKSRRRGNRR
Download sequence
Identical sequences I1GRV0
EG:BRADI1G19910.1 XP_003562584.1.954 XP_010234871.1.954 XP_014757863.1.954 15368.BRADI1G19910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]