SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G30650.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G30650.1
Domain Number 1 Region: 1708-1824
Classification Level Classification E-value
Superfamily Bromodomain 6.8e-26
Family Bromodomain 0.00026
Further Details:      
 
Domain Number 2 Region: 659-735
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000125
Family Ubiquitin-related 0.0046
Further Details:      
 
Domain Number 3 Region: 28-66
Classification Level Classification E-value
Superfamily TAF(II)230 TBP-binding fragment 0.000000589
Family TAF(II)230 TBP-binding fragment 0.0067
Further Details:      
 
Weak hits

Sequence:  15368.BRADI1G30650.1
Domain Number - Region: 1386-1420
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0283
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G30650.1
Sequence length 1831
Comment (Brachypodium distachyon)
Sequence
MSDGERRDDDVPTTSAADDDDDEDYEEPGGGNHFLGFMFGNVDDSGDLDADYLDEDAKEH
LFALADKLGPSLKDIDLTKSSPAPVDPSEQDYDEKADDAVDYEDIDEEYDGPEVEAATEE
DHLLSKKDYFSSNTVFASVNTKASVFDEENYDEDEEPPNDEEPTNNNELPSDSKASVFDE
ENYDEDEEPPKKHSSVEQLDMSPSNGIPTTEMMSGSLSPRGESMDIEYEVCQQDEVDTEE
DQLESKSATSLPVLCIEDGSVILKFSEIFGIQEPVRKPKTDHHKRPVSKEIHITSDIVED
DEEVFLRSTIQDLSYLKHIKMNEDVVESDSDDLISSDTFRLKDSCLSEQPMKDAYIDFPS
AQQSPVCPDFYPLEHEDWENGIIWGNSPANEGRHCLKSSIISEESGDTQEEEQAKDYGYV
SGCYDVQSKNNDSPLITEPFGCTEMPASASYHSPENSYPLLRKETPLEKNNLDEIEPNNI
NGTAKINTMKCLNNLSLLNKELLEGSWLDNIIWDPTEDTPKPKLIFDLKDDQMLFEILDE
KNGDHLRSHARAMIVSRPMKASAVEKFDHSNKAVTWSGQFNISNDNFYSNRKMSQQAKSH
TKKRSSMGIKVAHSVPAQKLQTMKPKLSNKEIVNFHRPKAKWYPHENKLAAKLQGDACSH
GSMTVIVMTLGGKGVKLVVNAEETPLSVKSKASKKLEFRPSEKIKLFGSGKELQDDISLA
MQNVRPKSILHVVRTEVHLWPKAQKLPGEDKPLRPPGAFRKRTDLSVKDGHVFLMEYCEE
RPLLLANAGMGARLCTYYQKTSPTDQTATSLRSNSDGLGTVLAIEPADKSPFLGDIRSGS
HQSCLETNMYRAPTFPHKVASTDYLLVRSPKGMLSLRRIDKLYAVGQQEPHMEVFSPGTK
NMQNYLLNRILVYVYREFRVREMPGVPSQIRGDELPIQPPLTEAIVKKRLKHCADLKKLP
SGHTIWIQRPDFRIPSEEELRRLLTPEMVCCHESMQAGQHRLKRLGIEKLTQPVGLASAM
NQLPDEAIELAAAAHIERELQITSWNLTSNFVACTNQDRENIERLEITGVGDPSGRGLGF
SYVRVTPKAPVSNSSHKKKSAAAKGTTVTGTDADLRRLSMDAARELLLKFGVPDEQIDKL
TRWHRIAMVRKLSSEQAASGITIDEIPVSKFARGQRMSFLQLQQQTKEKCQEIWDRQIQS
LSAIEGDDNGSDTEAHSDLDSFAGDLENLLDAEEFDDEDAGTADMRSDKADGMRGLKMRR
CPTQAQSNEEIQDDEAEAALVKKLLEDSGNDPKRKKQSVDLANYGTSMYNQGANKTKQGK
AGQMIKSSGYVSALLTPKEGTPRGGKEIEDSFTEGGLPSKLKTKQMVDANDIILVKKKNV
LGKDGFKEKRQGARGDSLVCGACGQLGHMRTNKLCPRYGEDPETLEMDALDVVSHVQAKT
QGKRLVAKVSSEVPETEGPESIEKIKPVKFRCGAPEKFLERNMSVAGSLVSDKSIMDATD
LRSTGKVSKIKICSKVKSEDYPLDTPKPSVVIRPPAESEKDVPRKKVIIKQPKGHVDLQR
ALEISSSQEPKKIRKIAELSSFEKKNREDDHLYAGEPSQMNSSTDRLGLEGNRKNKEVLG
GDESWRAFKEQRERQEQRLIEARIYEANREEELQKAKKKSKKKKKHEFRDDDVLDHRPYR
NERKVPERDRTAKRRTPADMTEFAPSAKRRRGGEVELSNILEKIVDLLRENTAISLLFLK
PVTKKVAPDYHDIILRPMDLGTIRDKARKMEYKNRDEFRHDVAQIAVNAHLYNDERHPHI
PPLADQLLEMCDYLLDESADVLDDAESAIEA
Download sequence
Identical sequences 15368.BRADI1G30650.1 XP_014752537.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]