SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G32480.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G32480.1
Domain Number 1 Region: 6-27
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000301
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G32480.1
Sequence length 319
Comment (Brachypodium distachyon)
Sequence
MAASAPTGCFKCGRPGHWSRDCPSAPPSSSTNPNPTTAGSSRFASFQPRQNPKPAAAAAA
EGDAAAQEGGKKKRKERATRPKLTPDLLLSDTGLGFVLRYFPKAFKPRAGPGHEVEDLGN
LIKLYTDWHSRLIPYYSFEQFVRKVEKVGASNRVRRCISELKDRVARGGDPTQLHEPPVE
EVMPEGEPDGATQEDSILGTEPPTTDSHVMESVQEDIDPPPVESNVDAMQEDLLNEIYEN
TVHESGVKPGEGGAVEPLAPREAEKCQDGGESGGSKPSQKVELTEEQRAHMEANRLKALE
RAAAARARGSQWQPTQTAT
Download sequence
Identical sequences I1GW33
XP_003560445.1.954 15368.BRADI1G32480.1 EG:BRADI1G32480.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]