SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G34000.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G34000.1
Domain Number 1 Region: 82-106
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000497
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  15368.BRADI1G34000.1
Domain Number - Region: 140-178
Classification Level Classification E-value
Superfamily Tumor suppressor gene product Apc 0.034
Family Tumor suppressor gene product Apc 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G34000.1
Sequence length 264
Comment (Brachypodium distachyon)
Sequence
MSGNDSQAAADRIKAQALSNAKGLSRAQAERAAEAAARNVNAYGQKEEGPSRWQERKEAK
RQMYLMSTEKAVKLGVRPNAMPTSSAGGQCQKCFQPGHWTYECKNERVYISRPSRTEQLK
NPRLKKAWLPASSQFVNPDLEKEMEEERKLMKEKLKKEKSERRKVKSKVKSKRKHRASVS
DSDSDSESSATGSEYSSESGSSSDSSSDSEDNKKRRRKTKQKKRRHRRDSTSSSSSESES
DSDSDSDDKGSRRKSKRRSDKRRT
Download sequence
Identical sequences I1GWM0
XP_003563495.1.954 XP_003563497.1.954 EG:BRADI1G34000.1 EG:BRADI1G34010.1 15368.BRADI1G34000.1 15368.BRADI1G34010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]