SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G46940.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G46940.1
Domain Number 1 Region: 167-291,394-511
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-36
Family Phosphate binding protein-like 0.0043
Further Details:      
 
Domain Number 2 Region: 9-111
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000549
Family L-arabinose binding protein-like 0.013
Further Details:      
 
Weak hits

Sequence:  15368.BRADI1G46940.1
Domain Number - Region: 285-374
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00133
Family Voltage-gated potassium channels 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G46940.1
Sequence length 662
Comment (Brachypodium distachyon)
Sequence
MAAAAAAAVRVGVVLDLTSDAGRERRDCISMALDDFFLEHPSYAPRVELLVRDSRGEIVT
ASHAAKDLINNAQVQAIIWGPQTLTKADHIIHLGRRNNIPVLSLSSISSTSCAFWLEDPK
TASRGRAKFGFTLGSDTITFNSPKTDRRNSRKLVAVKAKINCRGKTMLKIAVPKKTGFRV
FVNAIDPISKKQNITGYSIDIFEAAMRNLNPRPCYKFVLFEGTYDELVGNVSLGVYDGAV
GDVTITAERVSGTDFTMPYTQSGVSMLVLAEDAPETIRWTFVKPLSGRLWFATAVSFLYT
GFVVWMIEQPRNQEYEGSCLKQCSNALYFVFSTLTFSHGQSIKSPLSKIVVVIWCFVVLI
LVQSYTASLSSILTAKRLRPSVTDLNQLRLNGDFVGYQDGSFVRSFLMNHNISETKLRNY
TDKEEYADALKKGSKNGGVSAIVDEIPYLTSFLSDPRYKIDFKMLRSIYKTPGFGFAFRL
GSPLVRNLSTAILNLAGGNDEGSKIEAKWFGTASPLMGNAGTVTDTDSAPLTLQSFSGLF
IITGSMSTLMLLISIGRLVHAKCTGLRKANVVSDSYSAVDEDSHLSQNGMGDNPILDQQP
VPESGDEDLRGVHESGENAGDTEPGPVQPNGRHSGSVPAEHIQIIEMGTVRDESVREVPD
AQ
Download sequence
Identical sequences I1H069
EG:BRADI1G46940.1 15368.BRADI1G46940.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]