SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G51600.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI1G51600.1
Domain Number - Region: 524-573
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00195
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Domain Number - Region: 386-467
Classification Level Classification E-value
Superfamily IpaD-like 0.00471
Family IpaD-like 0.03
Further Details:      
 
Domain Number - Region: 301-360
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0301
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G51600.1
Sequence length 586
Comment (Brachypodium distachyon)
Sequence
MGEPARSMEVGIGSLSACSFASCDNLDGVQRNCRNDVPQCADEASVEEWSEVGAASVEAS
GLSASSRRKKSDAGPAVRLPVPGRSSPLENALRGFAHRTTENILLPEIGLCFDSLPEAYE
YFNLYSWEVGFGIRYGKSKSYKCKSGPKKDVVYQTMQEIVCGCEGIPKKKNTSSVRCGCK
CFIRLLRSGDHGWYIKECRLVHNHKLSRNSGEKMCWPSHKHIDRYTRELVRNLRENNVPL
TKVYSILGTYFGSTEDIPFNKRSLQNLCKQISREEANDDGGVVLKTGWPIEKHAATIYTS
VMLEMFSEHIFDSAGYNVIEVVPNKKYLTVHFDASRREKWSKVHYEVTISDDGGQYACEC
GLAEHMGMLCCHSIRVMLQLGVDKVPQAHILKRWTKDASDVLPDHLAHLQKDRGSTRSQT
YRHASLHVAALELANIGDKNIDCYHDVLKYITDGTKKFGEMYQQTDGRGLQELIAITNVH
PEPVDCSEVSPQQLNVAVIAPVRNRPEGRPTNSRDKPSYELKWKRTRFCTICKLSGHNRS
ACKANPDKPPVKRSDPKCGKCGVVGHRRNVCASSVDVQQIEYQLGV
Download sequence
Identical sequences I1H1U6
EG:BRADI1G51600.1 15368.BRADI1G51600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]