SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G62050.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G62050.1
Domain Number 1 Region: 511-631
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.37e-18
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G62050.1
Sequence length 640
Comment (Brachypodium distachyon)
Sequence
MGAEGDEEYSCSHGYKVGFPPEKGLLAEISDGVKETFFADEPLREYKGQPRSKKLWLGLQ
HVFPVLDWGRHYTLGKLKGDLVAGITIASLCIPQDIAYAKMAHLPPHIGLYSSFVPPLIY
ALMGTSRDLAVGPAAVVSLLIGTLLQSEIDPVKNPLEYSRLAFTATFFAGITQALLGFFR
LGFIVEFISHAALVGFMSGAAITIALQQLKGFLGIVHFTSSSDIISVMKSIWENVHHGWN
WQTILIGASFLAFLLATKYIAKKNKKLFWVSSIAPLISVIVSTFFVYITRADKHGVVIIK
DIKQGINPPSFHLIYFSGPYLMKGFRIGVITGMVALTDAIAFGRVFASMKDYQIDGNKEM
VALGTMNIVGSMTSCYVATGSLSRSAVNYMAGCKTTVSNVVMALVVVLTLVLITPLFKYT
PIAILSSIIISVVVSLIDYESVQLIWKVDKMDFVACLGAFLGVIFASVEYGLLAAVAISF
AKILLHVTRPRTALLGNLPRTFIYMNAEQYPEAIKVPGVLIVRVDSAIYFTNSNYVKERI
LRWLRDEDEQQKEQGLPETELLIVELSAVTDIDTSGIHALEELLKALEKRQIQLILANPG
PTVIRKLRSAKFMELIGDDKIVMSAGDAVKKFALKPAENV
Download sequence
Identical sequences I1H5C1
15368.BRADI1G62050.1 EG:BRADI1G62050.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]