SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G04710.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G04710.1
Domain Number 1 Region: 344-437
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000106
Family Adenain-like 0.0048
Further Details:      
 
Weak hits

Sequence:  15368.BRADI2G04710.1
Domain Number - Region: 243-277
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00706
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G04710.1
Sequence length 562
Comment (Brachypodium distachyon)
Sequence
MVDESIDEYLDIVERTFGFSVRKSYVEWDEASEEIILRKFVCSREGSREEKHMKREDRKR
RPHNLTRVGCRAKLVIARVKETGRWFVKDFIDEHTHPLAPRDLACLLRSHRRISDEQKAD
IVEMKISGLRKHKSWISWWTMSAKAAFPKTRKNNMYDYSVSLKRYRELRNLSHAACFLPS
QSVEAYDRLKLVLNVQADNKKSSSGHKECMRYGPVLPQTAQVDSGELEKVLDPVHVQGRG
APKKRLKRRKRKRSTVKCGYCRQEGNNRRKCSKWEEGILKSASYTAGFHAGLPPDEETEQ
VTMNICDGNGRMNIPNAQPTMPANEKIHADGDFSFEAQPGYLGISNQQEEIQVLNSIPHL
CDEAKETSLTESIQTCIEDAVKCSLVQAPVPINISQWNKVCYTNIPQQTDGHSCGAYTLK
YMLSWDGKKMAEDFTQKTAYEASIAKLVQLNAADDDVQEISPPDATNNKEKSPRDAANNK
ENSPPDAASKKDNPLHDASKSETSGCLKRKHGRPRKITPPKPTSHVAVIQQFATNAIAER
VEGRARRKTQPGRHTKSPYKEL
Download sequence
Identical sequences I1HCJ2
EG:BRADI2G04710.1 15368.BRADI2G04710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]