SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G08920.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G08920.1
Domain Number 1 Region: 82-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000968
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Weak hits

Sequence:  15368.BRADI2G08920.1
Domain Number - Region: 139-182
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0746
Family Eukaryotic type KH-domain (KH-domain type I) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G08920.1
Sequence length 458
Comment (Brachypodium distachyon)
Sequence
MAREPSPEIDDELFNEVYGKAYSGPVATATNSVTPKVNDEKKPLAHDKSDEEDDPRDPNA
VPTDFTSREARVWEAKAKATERNWKKRKEEEMICKICGESGHFTQGCPSTLGANRRNADF
FERVPARDKQVRDLFTERTISQIEKNVGCKIRMDEKFLFVSGKDRLVLAKGVDAVHKLIQ
ESKGKHSSSSPKRDRSRSPVRNSADFRLRHPDSRWSHSPRNASHSQSRGPHNERPLVGRL
RDDMPKYPKGSPQAYANNGAKDRPVRSKSPCEPSYLDDHLRSHGGNNQYATAHMPNNCST
ERYGTDSRLDLKFELPSYPQTLEELEIEFKREAMELARARDQEEDEENCKHRETLREIRE
NHMKRVSATRSMQARKWSEFLEQSFRRQQQAQQTSYTQTGYPDFDQRTAHFPTTAPAIDS
KNAYPYPTDNYSAAPRRHAYDEFQHERHGDLGRTYGRY
Download sequence
Identical sequences I1HDY5
XP_010230702.1.954 15368.BRADI2G08920.1 EG:BRADI2G08920.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]