SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G16080.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI2G16080.1
Domain Number - Region: 173-194
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0243
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 
Domain Number - Region: 254-325
Classification Level Classification E-value
Superfamily Coronavirus RNA-binding domain 0.0445
Family Coronavirus RNA-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G16080.1
Sequence length 430
Comment (Brachypodium distachyon)
Sequence
MYPPKVDAWITFQTRKADSQTAVCFDSDEWIYQVNEPGGATSDGVQHGGRAFEVSLRTCE
CSCKRPSLIHFACSHLRTAARLRHVDYNHPLTVRESEVTIEKTKLTWEGGFHPYLNQSRW
PEYHGLQLWPDLELKVVSRGRRKTKRFRGDMDGWSSGGRREWGNDIFHEPSVSARCGTCN
GVGHNTRGCSTQRGNKRSKGNEASTTQEVPIHGFGGQQGPSQGCGSRTGPSQGSGSQQFP
SQVGGGQQGSTVHVGTQHVPSPQGAPQQAPRRQQRVTVGRGMAASQPPKATAKWDEEEGS
LWWLRAAQAMREREAREAKEKQKQEDMERIRKITEKHEAWGRSLGDEESMRKKFAETHRE
YLLIQGLKESHARRMRHAQFVKASEAAEKLNAHKKKEFNKKVLREDRRQMEEEEEEDEKK
RKGKGPCPTQ
Download sequence
Identical sequences I1HGA0
15368.BRADI2G16080.1 EG:BRADI2G16080.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]