SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G32200.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI2G32200.1
Domain Number - Region: 69-95
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00593
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G32200.1
Sequence length 183
Comment (Brachypodium distachyon)
Sequence
MSSSPHGSSLSKATPIPRLLSWLVAVQVHAESRPCSRLKSQKRRSRNKKDEAPAPTNARA
RLEPELDANENPKGQRLCSNCNKIAGHNARTCKKRQMAKQLLEAHQKAYGASTMTEKVKI
CIKNALAKQVVGIEDTEQLLDTDEEEDYEDQIDDGESEDDVEDYDENEDDQGGEGEEEEQ
CQT
Download sequence
Identical sequences I1HKV2
15368.BRADI2G32200.1 EG:BRADI2G32200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]