SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G37420.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G37420.1
Domain Number 1 Region: 285-377
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.51e-22
Family Canonical RBD 0.0025
Further Details:      
 
Domain Number 2 Region: 183-272
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-20
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 3 Region: 384-451
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000371
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Domain Number 4 Region: 519-555
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000167
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 
Domain Number 5 Region: 585-616
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000171
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Domain Number 6 Region: 455-494
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000272
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G37420.1
Sequence length 620
Comment (Brachypodium distachyon)
Sequence
MVLARKKLKQKLRTLVPPGGEAEPGDDAEAQNIKVRLVSSKRPRPKRPKKPSPEEPPPAP
AAEEEELDKNVEGEAEEVVVVEEEDLEKQAVEEPEVDAAALALQAEVERRREERRKEKKE
KRRVRRLLEAEAAEKQKLEVAAADPAVSEDSEQILNITKVEGDENKNKSEVTGQGVGSDN
PIVSEDREQSIKKVYVGGIPYYSSEDDIRSFFEGCGSITALDCMTFPESGKFRGIAILTF
KTDAAAQRALALDGADMGGFFLKVQPYKANREKVKSNHEKEDFAPKMIEGYNRIYVGNLA
WDITEVDLRKFFSDCKISSIRFGTDKETGDFKGFAHVDFSDGTSLAVAMKLDQNVIKGRP
VRIRCAVPRKESQKPNDNANSDSSKNKIRTCFECGTPGHLSFACPNKKPSEDMSTETMAA
TDSAEAPSKKRRTCYECGVPGHLSSACPNRKASVVVTDEKKANIDSTTSASKKRRTCYEC
GIPGHLSSACPNKKAAEVVSNNMQPVDEPKSAPSMAFEQSKAADGSNSAPSKRRKCYECG
ISGHLSSACPNKKDSQINSNEAKPNGDSNTVPPAISDEKKASDDTNPAPPKKKKRRTCYE
CGIAGHLSSECPNKAAAQAS
Download sequence
Identical sequences I1HMC9
XP_003566627.1.954 15368.BRADI2G37420.1 EG:BRADI2G37420.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]