SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G42870.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G42870.1
Domain Number 1 Region: 115-171
Classification Level Classification E-value
Superfamily Homeodomain-like 8.97e-17
Family Myb/SANT domain 0.024
Further Details:      
 
Weak hits

Sequence:  15368.BRADI2G42870.1
Domain Number - Region: 3-23
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00628
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G42870.1
Sequence length 288
Comment (Brachypodium distachyon)
Sequence
MARKCSHCGNYGHNSRTCTSSAGGQREIMLCEGGGGGSGLRLFGVQVHVAAGAGAGASMR
KSYSMDCLQLAAAPSSLVSPSSSSSSSVLLSIDEGLERASNGYLSDGPHGRLVQERKKGV
PWSEEEHRLFLVGLEKLGKGDWRGISRSYVTSRTPTQVASHAQKFFLRQSSMGKKKRRSS
LFDMVPICENGMRASEQPSVRINNSDGASTSLPRYRPSSDMAAIDLNSTEEDDDMADVSL
SSASGASPRAPLIPAAALTMEHGHGGHQYCSRLDLDLGMSLSTPSIGT
Download sequence
Identical sequences I1HP68
XP_003569313.1.954 EG:BRADI2G42870.1 15368.BRADI2G42870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]