SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G06710.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI3G06710.1
Domain Number - Region: 21-91
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000183
Family PB1 domain 0.012
Further Details:      
 
Domain Number - Region: 697-717
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.046
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G06710.1
Sequence length 720
Comment (Brachypodium distachyon)
Sequence
MGSRQIVAVLQLGGVFTTDDDGGMTYSGGEAHAMHVKSGWTFKAFKNEISSTLNNLKLDS
YAFKYFLPRNNKTLISISNDKDLKRMVEFHAESETTYIYVIKKVENRVKSSVADSGAPAD
LAVIATTPDGSKRQKICASWENAITGAGQVFEGPKEFRDALHKYAIARRFHYRFIKNDST
RVTVECTDEGCPWRIHASKSPSKKEFMIKKVVGSHTCASETVNSHRLASQKWVASVIKEK
LRDSPNYRPRDIANDLQREYGLCLKYSQAWRGKLIARKELYSPHEEACNHLPWFRDRILA
TNPGSLATVVTLEDSKFRFFVAFHASLHGFEHGCRPLIFLDVISVKPNKHWKLLAATSVD
GEGDVFPVAFSVVDDECQENWHWFLEQLKASLPVPREITFISNGKSDLWDDVSLIFPDSY
HGYNINSFIEEFKTQLDDGWSEEVKDTMVEHLKEAVYSCTVDEFNHYIELIKAESDKLAE
WLMETKPERWSDAFFKGSRLGQYTSNISETIVDWMPSRYELPVVQLLDTIRCNLMEMIYT
RRESSNAWSEVLTPSANQKIQEEMSKVLSLSVVCSTENHGNNNVFEVCDGSVYIVNIDTW
ECTCRKWHVSGIPCSHALAVFERTEQNPLDYCAKYFTTECYRMTYAMSINPIPDVMVPSA
STDPSQSGGLVPCPILTRRQVGRPKEKPADPRIAIKRAVRCSRCKGYGHNKATCKVPITA
Download sequence
Identical sequences I1HY76
EG:BRADI3G06710.1 XP_003571102.1.954 XP_010233958.1.954 XP_010233960.1.954 15368.BRADI3G06710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]