SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G29820.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G29820.1
Domain Number 1 Region: 344-492
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.23e-44
Family Retroviral integrase, catalytic domain 0.006
Further Details:      
 
Domain Number 2 Region: 791-1013,1041-1226
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.9e-27
Family Reverse transcriptase 0.028
Further Details:      
 
Domain Number 3 Region: 44-80
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000855
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G29820.1
Sequence length 1274
Comment (Brachypodium distachyon)
Sequence
MTRAQWSAMAARKTGDSSSSSGRRDQAKGGGRAQAKKAPHGTEEKGAAPKKKFDCKKVRC
HNCGIYGHFKSECRKPQKEKAYMAREEDDDPALLMVQMCELMEEGQEEVIKEKSESVTLV
EKKVYLHDKARVKAGNVWYLDTGASKHMTGDKTQFAELNLAVGGSVRFGDGSTVAIQGRG
TVLFETRFGDHKVLTDVYYIPKLKSNIISLGQLEERGCKIVLDDGYLWGYDRQRKLLMKV
KRAKNRLYILDLDRTEPICLLAGLDDPAWRWHARYGHLNFHSLRQLGQKDMVVGMPTVDH
VEQVCDGCLVGKQRRAPIPREAKYRAEKVLDLFHGDLCGPVSPATPAGNRYFLLVVDDYS
RYMWVVLLKTKDQAFQAFKKIKIAAEVEAEAKLKAFRTDRGGEFISHEFAAYCEEHGIKR
FLTAPYTPQQNGVVERRNQTVVAMARSMMKSKGLPGRFWGEAVTTAVYLLNRAPMKSVIG
MTPYEAWCGRKPSVDHLRTFGCMAHVKNVSGHVGKLEDQSKPMILMGYEAGLKGHSKAYR
VYDPQTRKVHVARDVVFEDERAWDWSSNKEENQQNSDDMFVVSYPVPEHAGHNHGEGHGH
DVGGGDPPGTPQCRGATPVFSYSRAPASSSAAAGSAAGTAAGISPAAGSAAENSATAEIA
AGRSASATTRETAENPSAAAGASEGEDATAGGDAETSTAAATSQRASTMVRSPVQTRSRT
RRPTPKRLRPLSELYPSPKKMIRKTKTVKMKRTAKERCLLSTEEPTSFEEASEEESWRKA
MEEEMGSIQDNKTWSLVDLPAGHKPIGLKWVFKVKKDSNGNVVKHKARLVAKGYVQQQGV
DFEKVFAPVAWMESVGLLIALAAQESWKLHHMDVKSAFLNGDLQEEVYVQQPPGFVEGGA
EHKVLRLHKALYGLRQAPRAWNTKLDATLVSLKFEKSPLEHAMYKRGDGKERLLVGVYVD
DLLITGADEREIARFKKQMLDLFKMSDLGLLSYYLGIEVCQRGDSITLCQEAYARKILEK
CGMEDCNATSAPMEARHKLSKHSEADPVESTEYRSIVGSLRYLVNTRPDLAYSVGIVSRF
MQNPTTEHFAAVKMILRYIKGTLNYGCVYSKKKEEKTQLVGYSDSDMAGDVDDRKSTSGM
AFFLGGNIVSWMSQKQKVVALSSCEAEYIAAATAACQGVWLERLLADLLNREPEKFELKI
DNKSTISLCKNPVFHDRSKHIDTRFHYIRECVEEGKLDVDYISTDEQLADILTKSLRRLK
FQEMRKKIGVDVIK
Download sequence
Identical sequences I1I518
15368.BRADI3G29820.1 EG:BRADI3G29820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]