SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G32520.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G32520.1
Domain Number 1 Region: 214-259
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000436
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Domain Number 2 Region: 78-115
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000858
Family Retrovirus zinc finger-like domains 0.0019
Further Details:      
 
Domain Number 3 Region: 121-160
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000462
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 
Domain Number 4 Region: 34-77
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000136
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 
Domain Number 5 Region: 159-182
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000384
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G32520.1
Sequence length 270
Comment (Brachypodium distachyon)
Sequence
MSSRSPPPRDRRMRTERTSYRDAPYRRDRDSRHGRSSRSDLCNNCKRPGHFARDCPNVAV
CHTCGLPGHMAAECSSKGLCWNCKEPGHMANSCPNEGICRNCGKSGHIAKDCSAPPMLPG
EVKLCNNCYKPGHIAVECTNEKACNNCRKSGHLARNCTNDPVCNLCHVAGHLARECPKSD
EIIERGGPPLRGSGALFHGGDIPFRGGGGAPFRGGGYSDMVCRICNQVGHMSRDCMDGAF
TICHNCGGRGHMAYECPSGRLLDRFPPRRY
Download sequence
Identical sequences I1I5V4
EG:BRADI3G32520.1 XP_003574286.2.954 XP_010234960.1.954 XP_010234961.1.954 XP_014756355.1.954 15368.BRADI3G32520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]