SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G32700.2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G32700.2
Domain Number 1 Region: 109-161
Classification Level Classification E-value
Superfamily RING/U-box 1.97e-20
Family RING finger domain, C3HC4 0.0036
Further Details:      
 
Weak hits

Sequence:  15368.BRADI3G32700.2
Domain Number - Region: 155-182
Classification Level Classification E-value
Superfamily Killer toxin KP6 alpha-subunit 0.0654
Family Killer toxin KP6 alpha-subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G32700.2
Sequence length 217
Comment (Brachypodium distachyon)
Sequence
MATASSHARRLAARNEVTTATPAVGPSQTTSGRGPAAQFDLSSGAATAVVFLSIVLCFIL
LCTYCRCARQRARAGRAAAGFPTAAFLLRPADAASLPVVPYAGATTKGQERDCPVCLEEF
GDDDGVKVVPACGHVFHAACIDRWLGVRNSCPVCRCAVVCYCAAAGDGRDASVAAGAGDG
DDDQEVVLERVVAMIEAIREEQAAARRAQGSAAAGGR
Download sequence
Identical sequences I1I5X9
XP_003572043.1.954 XP_010234979.1.954 EG:BRADI3G32700.2 15368.BRADI3G32700.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]