SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G47070.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G47070.1
Domain Number 1 Region: 1373-1653
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.14e-42
Family Hypothetical protein VC1974 0.001
Further Details:      
 
Domain Number 2 Region: 1095-1280
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.99e-39
Family D-glucarate dehydratase-like 0.00056
Further Details:      
 
Domain Number 3 Region: 359-532
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.28e-33
Family Pyruvate oxidase and decarboxylase Pyr module 0.0024
Further Details:      
 
Domain Number 4 Region: 698-907
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.83e-20
Family Pyruvate oxidase and decarboxylase PP module 0.014
Further Details:      
 
Domain Number 5 Region: 942-1071
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.000000596
Family Enolase N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G47070.1
Sequence length 1657
Comment (Brachypodium distachyon)
Sequence
MLAVSGSPRFPLPFLPVPNPRPPIAYHLRRYCLYRHRLRRQCRGGGLPLRHLCAVARRPT
GIVIDVDRVDDVGDRDLPVDISFVRRLPPALTLADGIATLRRAAQEVKASPPAVGSGVIR
FEVLVPPGTKALKWLCSQFRGSSLFPQFYLSRKLSSDPPIELQICGVGSALCLHGSSEVK
NGCDLISRYLSFDSDLIRAYGAVGMKYDKEILSIEEKSGSFYFFIPQVELSEYDGYSVLS
STIIWDHSVSHTFEDSVCLFESCFNQVCGSYDSSASICYDNMMTSYIGDSYLLETGNAQL
VYLDTEVLAKVDAKTSMQKEKFLTSEKSFICFSSEFLFSANVDLRSQMYKTESFIRSGSN
INSAWASLIVEECVRLGLTYFCIAPGSRSSPLALSATGHPLTTCISCYDERSLGFHALGY
GRGSRKPAVVITSSGTAVSNLLPSVVEASQDFIPILLLTADRPPELHDAGANQAINQVNH
FGNFVRYFFNLPPPGDQIYARMVLTTVDSAAYNATQAPQGPVHINCAFREPLDHSSQNWS
FDCLRGLDRWFRNDEPYTRYLGMKMVSAFGNYSSSVVEVLDIIKKAKQGLLLVGAIHTED
DMWAVALLARHLSWPVAADILSGLRMRKVLNSFPGLAKRILFIDHIDQILLSDSVKSWLN
PDVILQEDKQMAGYFDGPEFSGMSQNMVSQEIMFHVHSEFSLTEPYVAHVIGEALYGDAI
MFIGNSMVIRDLNMFGKSWLDHTTNGGNAMMHNFPDFVGATVAGNRGASGIDGLLSTAIG
FAVGSNKHVFCVVGDISFLHDTNGLSLLNQRAQRKPMTVIVINNHGGAIFSLLPVAKTTS
PEILQKFFYTSHDISISKLCAAHRVNHFLVQTKAELHDTLVKTRAEHVDCVVEVENCIDE
NANFHRIISMFADNTATHYLDYLLRDPYSWTSSDLDDMHINKIHAMEYMLYRIQLSAPRT
SGISDSSFFHEGFILKLCMDDSIIGFGEVAPIEIHEEEMIDVEEQLRFLFHKVKDCDLNI
VPLLRGSFSNWIWESLGIPPSSVFPSVKCGLEMAILNLLASRQKCRLSEILTGPNPLLRD
QSLVEYNRNSSESIQICALLDSNDTPMEVALAVAKLVAEGFTTVKLKVGRRESPTEDAAV
IQKIREVVGYNINIRADANRKWTYEQAIEFGSRVKSLCLQYIEEPVSSVNDLIAFCETSG
LPVALDESIDGLKGDPIHKLHQFVHPGIVAVVIKPSIVGGFESAAHIAKWAHMHDKMAVI
SSAYESSVGLATYIQFAYYVDRQNDLVSRIKKSDSCGSVAHGLGTYQWLREDVSEQKLKI
HISPIGDGMRASVQDANGYLQHLSINNQKIERTYSEEKLRSYSIRVDGDDFSYVVRLQEA
GDCTNDKIVLFLHGFLGTSEDWTPMMKALSPSARVISVDLPGHGRSQILQHDGVNSSQLS
FTIQSVADLLLKLICRITDGEVVVVGYSMGARIALHMALNQNNKVSGAVLISGNPGLRHE
VSRRRRAAIDKSRAQLLLSYGLECFLETWYSGKMWASLREHPQFDSLVRTRRKHGNIKDL
SKVLADSSIGIQKSLWEDLKHMERPLLIVAGEKDLKFKEIAGQMCREIRMCEECEADCGN
RQELCEMIIVPESGHAVHVENPLYLVRAVRKFLLKLL
Download sequence
Identical sequences 15368.BRADI3G47070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]