SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G48460.2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G48460.2
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.76e-16
Family Canonical RBD 0.0019
Further Details:      
 
Domain Number 2 Region: 82-106
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000464
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G48460.2
Sequence length 234
Comment (Brachypodium distachyon)
Sequence
MARVYVGNLDPRATAREIEDEFRVFGILRSVWVARKPPGFAFIDFDESRDAKDAIRELDG
KNGWRVELSTKSGSGRGRERERPGGSDMKCYECGESGHFARECRLRIGSGGLGSGRRRSR
SPRRSRSRSPRYRRSPSYGRRSYSPRDRSPRRRSYSRSPPPPRARSISRSPPPPRARSIS
RSPPPPRARSISRSPPPPRARTISKSPPPPRERSYSRSPAQPPQREESPYANNA
Download sequence
Identical sequences I1IBG7
15368.BRADI3G48460.2 XP_010235684.1.954 XP_010235685.1.954 EG:BRADI3G48460.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]