SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G53760.3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G53760.3
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.17e-19
Family Canonical RBD 0.0019
Further Details:      
 
Domain Number 2 Region: 89-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000912
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G53760.3
Sequence length 194
Comment (Brachypodium distachyon)
Sequence
MARLYVGNLDARVTAGELEDEFRVFGALRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG
KNGWRVELSRNSSGRGGGRDGGGGGRDRHGGSESKCYECGESGHFARECRLRIGAGGLGS
GRRRSRSRSRSPRNRRSPSYGRRSYSPRDRSPRRRSVSPARGRSYSKSPTYNRGRDDSPD
AKGNDGTRYRRSRS
Download sequence
Identical sequences I1IDC3
EG:BRADI3G53760.1 EG:BRADI3G53760.3 15368.BRADI3G53760.3 XP_010235900.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]