SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G57510.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G57510.1
Domain Number 1 Region: 178-374,445-505
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.07e-30
Family Voltage-gated potassium channels 0.0055
Further Details:      
 
Domain Number 2 Region: 509-707
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.03e-27
Family cAMP-binding domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G57510.1
Sequence length 770
Comment (Brachypodium distachyon)
Sequence
MADQERDDIPMLLRNIELPRFPRSTSMCIPVRDDDYEEETFVSHTGPLFSQPPTQTAAAG
NLFTSRHTPDKLPPRHPQGKQVSKPQAVMPEEAGGNRWSHSGDIPKNEHLMMSGPLGQCD
NPDCVNCPPACKNKRHFQKLPNPFDNKLHNILYGHHQGWKNRIERYLSYIPIMNPHAKVV
QHWNQFFVISCLVAIFIDPLFFFLLSVEKDNKCIVLNWKFATGLAVVRSVSDAIYFLHML
LQFRLAYVAPESRVVGAGDLVDEPKKIAAHYLRGYFVLDFFVVLPLPQVMILVVIPKYVG
LSTADIAKNYLRVTILLQYVPRILRFVPLLGGRQNATGFIFESAWANFMINLLMFVLAGH
VVGSCWYLFGLQRVNQCLQNACSASNIPSCEALRDCGRDIDFGWQNYQNRQQWLNDSAST
DCFKTGDDATFQYGIYQQAVLLATKRSAVKRYIYSLFWGFQQISTLAGNLVPSYFEGEVL
FTMAIVGLGLLLFALLIGNMQNFLQALGSRKLEMQLRRRDVEQWMSHRRLPEDLRRRVRH
AERFTWAATQGVNEEELLSNLPENIQRDIRRHFFRFLNKVRLFTLMDWPILDAICDKLRQ
NLYISGSDILYQGGPVDKMVFIVRGKLESISADGSTAPLHDGDVCGEELLTWYLEHSSAN
RDGGKIKFHGMRLVAIRTVRCLTNVEAFILRASDLEEVTSQFARFLRNPRVQGAIRYESP
YWRTIAAARIQVAWRYRRRRLKRAERSRLSEESNRIPGWSDHAFQHGQRG
Download sequence
Identical sequences I1IEP7
EG:BRADI3G57510.1 XP_003570538.1.954 XP_010236052.1.954 15368.BRADI3G57510.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]