SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI4G08170.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI4G08170.1
Domain Number - Region: 96-124
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000147
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI4G08170.1
Sequence length 372
Comment (Brachypodium distachyon)
Sequence
MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYAPENNNKQQAPSSSVSANAAAAA
ANAAAEAAAPSAASDPASDNAYTSFQGLLALARVTGSNSDETRGACKKCGRVGHLTFQCR
NFLSVKDLEMDDDVHASVQAAALAKFHEIKKKASGGQGAQEEGSDEEDEDEDDSDSSDSD
IDPELEKIIAERERAKSGGGRRSKEEDKKTSRHRNSSRGRSKHRRSKKSESEDECKEKRS
KDNKKSRRKKDERSDQDSESDSDRKRHRKSRKDRKKRRTRSRKDDSPDKDESGGEDGKRR
RTHKRRHHRRNASDSDSADSESPHDRKRSSKQKRHQRSESCGFNEDEGHGQQGAKRSGEK
SREHKGGAKEVC
Download sequence
Identical sequences I1IIQ0
15368.BRADI4G08170.1 EG:BRADI4G08167.1 XP_003576706.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]