SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI4G15700.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI4G15700.1
Domain Number 1 Region: 78-118
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000015
Family Retrovirus zinc finger-like domains 0.00083
Further Details:      
 
Domain Number 2 Region: 118-165
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000157
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Domain Number 3 Region: 194-244
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000291
Family Retrovirus zinc finger-like domains 0.0011
Further Details:      
 
Weak hits

Sequence:  15368.BRADI4G15700.1
Domain Number - Region: 166-196
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0663
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI4G15700.1
Sequence length 387
Comment (Brachypodium distachyon)
Sequence
MSVTWHLCLVFLKIALECIDECICPFQPQVAGTQEGQTGIAEVVLTEGGVDVPLSDNTVL
RKLLRIPRYFDPGETILETCFNCGEEGHVATNCTMEKRKKPCFICGLFGHIAKQCTQGQD
CFICKKGGHMAKDCPDKHNINTQQSTTLCLRCGEIGHDMFACTNDYPRDDVKEIKCYVCK
QSGHLCCTDFSDNCPKEVTCYNCAQPGHTGLGCAKQRRETSVATTPTLCYKCGKEGHFAR
GCTNIANSDRFKGELSAHSRKKDKWKKDSGPRSAPHDGYKRKSPLFEDRRDTPHGKSRRG
GWIPDDHDDLPFKKYKSNGWASPSTPKKPYTNHHQRSSGSDYSTPRSSKWKNQGFSSPSS
NYSPNSRKHAFSSSRFSTNTHLHFERS
Download sequence
Identical sequences I1IKX7
EG:BRADI4G15700.1 15368.BRADI4G15700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]