SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI4G17910.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI4G17910.1
Domain Number 1 Region: 181-222
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000209
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI4G17910.1
Sequence length 669
Comment (Brachypodium distachyon)
Sequence
MEGRGEGQGDWRGTRPNGFGGGAVGWEGRPSGNWNGWQGPPPPFRPPQPHLGAAPSFQVR
PADQYAQSGRGYSSWDPRFQSGSQYRGQMVQGQGFPNPEQFNFSASGYVQPGHGGFSGGQ
PLASGGPPPGGQIGTAPMPPSQVGAYRGESSGSAQGSVQSGAMGQVSPTNSDGSKSVEQR
EGLAVKICYRCELPGHGIKACKIVLFCVVCGKDTHMVTKCVMHTQAKPISQLVGSAADGL
QMFIAPVTKKATVESKDAMALVSVHFGEITAEQLVNAFNRMFQWGWAWSAKPFAPSSFLM
RFPSVQKIDEINQFNDFCLVGERAEVMHPTQAEQQAARELKRQKSTQENQMSQEGGNDNT
TVRDVNNDKFSDMEEEGLLSSQPDLNGLALTSHQAGKLDGHALDQHSRGSESAIDRINSK
FATAAEKIDNLDCFEDESEPQSSTQFARDCGLGTQAINEMNSMDYDVESPEHIIPICTPE
GQKGDKPALVKDGKAKKLAAVDEGNRRGSNRNIHDDKATLDKAMDRAKVKNLDAGKGNKS
PSLFPIVLSTHNDTLVDIANKLGVQLGSSATEVDDNLNVIKELEQARAVMFLNSTKLSND
KVQLHEDLVNSFDPETLEKMDSSSEDEHEEDFVEMFEARFNSGNRKMSGYTGVASVKPKI
MIRKNSKRK
Download sequence
Identical sequences I1ILJ3
15368.BRADI4G17910.1 EG:BRADI4G17910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]