SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI4G22570.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI4G22570.1
Domain Number 1 Region: 273-403
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000202
Family Ribonuclease H 0.018
Further Details:      
 
Weak hits

Sequence:  15368.BRADI4G22570.1
Domain Number - Region: 26-44
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0759
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI4G22570.1
Sequence length 421
Comment (Brachypodium distachyon)
Sequence
MADYDGKSDVTPTEHFLLDVKYEKLGFFCDFCGHFGHNQEECGDGLHDPSMLQYGKWFLA
KRRVSSTSFSSGIRAPSSGRRGGRGGGRGRDMGSLKRSSQEADLSTEEELQDTGASPIKT
VNERVDGGSPPSAQKKLDLGGDAHADSKVQDVTMGDSKDEHGAKNQSELTPRPPPKYMKP
KDHKREKWKEKLMSRSMFDLHGKLSGIAGDLATWNDEVFGHVIHEDIYQSPVCISGFVKK
LLSELQVTSQPSISRPRVPEAVVSRWLSPPPGYLKINVDGGLTKSNGKGASAAVCRDETG
RYQGSSARVFDHISDPPTLEALACCEALALAQDLHAQKLCISSDAATVIKEIIGGSRCSY
SSILREIGVRSRQFQDVIVIHEGRAPNKDAHTLVKSVLSLQQCRYVWLIEPWSDSIVPPF
C
Download sequence
Identical sequences I1IML7
EG:BRADI4G22570.1 15368.BRADI4G22570.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]