SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI4G23650.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI4G23650.1
Domain Number 1 Region: 469-596
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000303
Family Ribonuclease H 0.0087
Further Details:      
 
Weak hits

Sequence:  15368.BRADI4G23650.1
Domain Number - Region: 332-349
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0628
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI4G23650.1
Sequence length 624
Comment (Brachypodium distachyon)
Sequence
MVPPRPRNLSALCAALSVPPCGHGKEAGHPVKGWARNAPNPEDSEADPGWKCSSWGFIAL
RAWRSRERFNRSTANSSSSKAKASRASAVEVEEVVAELAAEKVVHGTSAVQNLESLGDGR
SEGSKRSGEGGKVPLAELLSSLNLREDEEEEIILEEDLDELAVSARWLSLATVHTSRTFS
HGSLYGDMRAAWNLAKDVEFRAIEDNLFSVQFYCLADWEHDMRGGPWLFRRCSVSMSEYD
GWGEVEDVELSKFPAWVHVLDLKEKMRTGNIARQLSKHAGEFVALDEQSVKGASGGVRVR
VMIDARKPLARATTITLSNTKHYFWFQYEKMPDYCGVCGYVGHVEKECGDGVWPEEKIIY
KPDLIVPAFRRDLPSFNGGRARGRGRVIPLIWRLWQLRNDVTHEKPPAPIEATRRYLCSY
ADALFAIAQNDGRDVIKGKRVVGCFGGKKQNYKSHQVAPCDPWPSLMGGWIVVSTDGLFK
DGETGLGAIIRDESGEVLVSAYRFMPHCADALEAEAEAALEGIRLATCHADHPVLLQLDS
DVLVQALNGSELNRSGICFILSEFRCVSSGLSELVIKKISRSQNRVAVLLANLGRRARGL
DVLLNQPQPSILVAVATDCNPIIK
Download sequence
Identical sequences I1IMX0
EG:BRADI4G23650.1 15368.BRADI4G23650.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]