SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI5G14940.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI5G14940.1
Domain Number 1 Region: 10-61
Classification Level Classification E-value
Superfamily EF-hand 0.000000000144
Family Calmodulin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI5G14940.1
Sequence length 91
Comment (Brachypodium distachyon)
Sequence
MAIFAYGKVNGMLTKHDLTPAAQHVCGVELSDRVVEVIFHVFDTNEDGNLSSEEFLRAVQ
RRENNIHQPTMRRSVGWLNSKRCSWLPQMIL
Download sequence
Identical sequences I1IZE2
EG:BRADI5G14940.1 15368.BRADI5G14940.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]