SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI5G17970.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI5G17970.1
Domain Number 1 Region: 121-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000284
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Domain Number 2 Region: 65-114
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000186
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 
Weak hits

Sequence:  15368.BRADI5G17970.1
Domain Number - Region: 170-195
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00593
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI5G17970.1
Sequence length 277
Comment (Brachypodium distachyon)
Sequence
MPNKRQREARKRFREANPDLCQPAPAPPADGTKKKSKKSMFKKVKKAGGGGSGGAGRSKH
PLRVPGMRPGERCFICKSTDHVAKTCPEKSLWDKNKICLLCRERGHSLKNCPEKSDGDLK
KFCYNCGGSGHSLSKCPKPIENGGTNFASCFVCKQQGHLSKDCPENKHGIYPKGGCCKVC
GEVTHLARHCPNKRQQDFMYSRDDDTNMEGDHQEDHALRGGDDLEDDFIDEEETKPTKTK
KGKLPSSDSATAAGNGEKTANAKTKGKQAPKVVKFFG
Download sequence
Identical sequences I1J0F8
EG:BRADI5G17970.1 15368.BRADI5G17970.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]