SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 156889.Mmc1_0244 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  156889.Mmc1_0244
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily GlnB-like 2.37e-33
Family Divalent ion tolerance proteins CutA (CutA1) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 156889.Mmc1_0244
Sequence length 117
Comment (Magnetococcus MC-1)
Sequence
MSTAQGIIVWCSVPDQASANTLSQRLVEQKLAACVHTLPQGRSTYRWLGKVEHQSEHLLM
IKSHPRCETALIEAICANHPYEVPEIILTRIDAGLPAYMQWLAQSVEQNPLSPEQEP
Download sequence
Identical sequences A0L478
156889.Mmc1_0244 2005255819 gi|117923560|ref|YP_864177.1| WP_011711943.1.83473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]