SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 156889.Mmc1_0379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  156889.Mmc1_0379
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000804
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 156889.Mmc1_0379
Sequence length 121
Comment (Magnetococcus MC-1)
Sequence
MAEVREGSVWVLCACEYLHGDRYAQFERLREDLHNSRQVELVVFNVGMMKTLNSEQLGKL
IQISNQDKYEVCLTNVSEQNYALMKLIGLERFVKIYDKPQAEALAKEHRILSAFDCLYGD
G
Download sequence
Identical sequences A0L4L2
gi|117923694|ref|YP_864311.1| WP_011712075.1.83473 156889.Mmc1_0379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]