SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 156889.Mmc1_0957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  156889.Mmc1_0957
Domain Number 1 Region: 97-189
Classification Level Classification E-value
Superfamily Agglutinin HPA-like 6.67e-17
Family Agglutinin HPA-like 0.0025
Further Details:      
 
Weak hits

Sequence:  156889.Mmc1_0957
Domain Number - Region: 30-136
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0392
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 156889.Mmc1_0957
Sequence length 193
Comment (Magnetococcus MC-1)
Sequence
MSFLKQIFAYIAASLLLLLLLVGTMAAINQWQQNSTTAASQQPATAPQAATSPAQPFSPQ
APPLTPTAQAEIVKRLTQLETQQAKNIKRLHAVTNLQTAQGTVEITKKDNRWELTNLFTK
TRVYRQPILFSPPFTRLPKVMVALQGLQLDKATTLKIEAQNITPQGFELVVTSQSDQRVE
QLTSGWLAVEGDS
Download sequence
Identical sequences A0L682
156889.Mmc1_0957 gi|117924264|ref|YP_864881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]