SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 156889.Mmc1_1562 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  156889.Mmc1_1562
Domain Number 1 Region: 139-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.12e-133
Family Enolase 0.00000000411
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.23e-57
Family Enolase N-terminal domain-like 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 156889.Mmc1_1562
Sequence length 429
Comment (Magnetococcus MC-1)
Sequence
MSSIVEIHGREVIDSRGNPTVEVDVYTEDGGFGRAAVPSGASTGSREAVELRDGDKSRFL
GKGVRKAVDAVNTVLAEVVLGMEVADQKGIDAAMIALDGTHNKSRLGANAILGISMAVAK
AAADECDLPLYRYLGGTNTSLLPVPMMNIINGGAHADNNVDIQEFMIMPVAATSCTEAIR
MGAEVFHSLKKVLKSKGLNTAVGDEGGFAPNLGSNEEALKVIVEAIEAAGYKPGEDIKLA
LDCASSEFYNKETGNYDLTGEGRVLTKQELVAFYEDLVAKYPIISIEDGFDESDWDGWKL
MTEALGNKIQLVGDDLFVTNSKILAEGISKGIANSILVKVNQIGTLTETFEAVEMAQRAG
YTAVISHRSGETEDATIADIAVALNAGQIKTGSMSRSDRIAKYNQLIRIEEELGGMARFE
GMKVFYNLR
Download sequence
Identical sequences A0L7X8
156889.Mmc1_1562 gi|117924860|ref|YP_865477.1| WP_011713221.1.83473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]