SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 156889.Mmc1_1564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  156889.Mmc1_1564
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.29e-19
Family DNA-binding N-terminal domain of transcription activators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 156889.Mmc1_1564
Sequence length 148
Comment (Magnetococcus MC-1)
Sequence
MVKIGVVAKRLGVSIRTIHMYEREGLFIAYKNNAGTRYFNERDVEWLLEVRKLIKTGISI
AGIRRLMSLIPCWESKKCSFHNKHNCPVIEDNQLPCWANKDNLCDHSGQECRECEVYEMR
FCVSKLKNYIDIRFKDDAGDELRLVGRA
Download sequence
Identical sequences A0L7Y0
WP_011713222.1.83473 gi|117924862|ref|YP_865479.1| 156889.Mmc1_1564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]