SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 156889.Mmc1_3103 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  156889.Mmc1_3103
Domain Number 1 Region: 45-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000116
Family Anti-sigma factor antagonist SpoIIaa 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 156889.Mmc1_3103
Sequence length 108
Comment (Magnetococcus MC-1)
Sequence
METLRSCQYFNIYLSEHDVEIIPHQAPSFATSSYYLILAQQVPQDLHVIFNCSTFDHIDS
GGLGTLILFHNNLAHLNQPVTLREIHPKVMKKLKTAHLQQLFHLEELP
Download sequence
Identical sequences A0LCA0
gi|117926382|ref|YP_866999.1| 156889.Mmc1_3103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]