SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 159087.Daro_0202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  159087.Daro_0202
Domain Number 1 Region: 353-431
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000147
Family Anti-sigma factor antagonist SpoIIaa 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 159087.Daro_0202
Sequence length 436
Comment (Dechloromonas aromatica RCB)
Sequence
MVFSFFKKQPNKMPERPAARPRVAEPLPEPDLPKPVVGEAPRPLPQPLPDLEFTSGKSSA
PAAGVAAKPKAAVETANLSSSQIKPPVEETDFSFDDFDRDFTDSSVMGIDVDQDVDPLQA
CVEQVVVLYANGQEGAARSLLETFVRSYHGTEGKRFWLLLFDLLQISGDRAAFEKLGADY
AEACETSPPTWCQKSSIAQQPTGSVGPRKVFLQGVLTTEGALPVTELAKIIGQKEAATVD
CGKLIGCDDEIASELADLLSRARKMRLAVTLLGPEAFMDRLNDRLVAGVAEHESAWRLLL
ELLQRHGTQDKFEERAVDYAITFELSPPSWEPLAPSVQASAMTPKTSDDAHYLSGDLKGC
RFEDLGQVIEAHEQPILDFSGVSRLDFVSAGQLVNRLAPYKAAGRDIIIRSPNHLVAELM
AVVGLNKQARIVVPKS
Download sequence
Identical sequences Q47JM0
WP_011285971.1.67134 159087.Daro_0202 gi|71905844|ref|YP_283431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]