SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 159087.Daro_2064 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  159087.Daro_2064
Domain Number 1 Region: 21-92
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000275
Family DNA-binding N-terminal domain of transcription activators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 159087.Daro_2064
Sequence length 106
Comment (Dechloromonas aromatica RCB)
Sequence
MDKDKMLPQPSAIILEEQTDLTLSDVSQACAVRVETIVELVDEGVLTPSGREPHRWLFTG
THLRRATVAIRLQRDLGVNLAGAALALQLLDELEALQARLRKAGAL
Download sequence
Identical sequences Q47EC3
gi|71907691|ref|YP_285278.1| 159087.Daro_2064 WP_011287810.1.67134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]