SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 159087.Daro_2294 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  159087.Daro_2294
Domain Number 1 Region: 14-77
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.91e-16
Family SinR domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 159087.Daro_2294
Sequence length 80
Comment (Dechloromonas aromatica RCB)
Sequence
MLSRMVTPFSQLQRRLARNMRQARIRRGLSQEALALEAEIDRTYVSQIERGIGNPSLRVM
SQLSSVLETEVDELLKEIGS
Download sequence
Identical sequences Q47DQ0
159087.Daro_2294 gi|71907914|ref|YP_285501.1| WP_011288030.1.67134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]