SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 159087.Daro_3904 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  159087.Daro_3904
Domain Number 1 Region: 593-724
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.01e-29
Family cAMP-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 460-572
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 159087.Daro_3904
Sequence length 736
Comment (Dechloromonas aromatica RCB)
Sequence
MQDVFKKLYQSGDFWGGLAAMLVALPAAIAFGVTIYSAIAPSHAALGALAGIIGASVIGL
IASTLGGTDRLISAPCAPAAALLSAFAIELVAQGIPGGNIILLLLMLGVLAGMFQVLFGF
VGIGRLIKYIPYPVVSGYLTGVGLIIIGSQIGKLLGTPTGARWYEVLYTPSLWDWRALAV
GLTTMLVMWLSPGLTRRLPATILGIAAGIACYFALASQDESLLQLAANNLVIGPLGASGE
GYIQSITARWNEIGDLRLGQVAALLGNALTLAVLLSIDTLKTCVVLDQLTRSQHNPNREL
VAQGIANIASSSVGGIPGAGTMGATLVNLSSGAMTRASGLVEGISALVFALLLSSFIAWI
PVAALAGILIVVGIRMIDRGPLRFVQSSATVFDFGVVVTVVVVALTIGLIAASATGVALS
IILFLREQIGGSVVRHKFYVNQMSSSWHRPEAETRILEKKGDQAVIFELQGSLFFGTTQQ
LYSQLEPELKSRNFVILDMKRIQSVDVTAAHLLSQVRDSLAERNALLILSNVRENLPNNR
NLREFLAQTGVTDIPESVRLFDELDSAIEWVEDRLLGSREEQASPETETPLELQEMELFK
HRKDETLADLEKCLVKRHYAAGDVVYSQGEAGDEIYLIRYGSVKIFAPLGGGRTRHVATF
GRGDFFGGLAFLDGLPRGNDAVAASDTEFFILSQEQFNILSEEHKKLALTLLQALARSLA
LRLRHADTENAMRQEY
Download sequence
Identical sequences Q478U9
gi|71909515|ref|YP_287102.1| 159087.Daro_3904 WP_011289627.1.67134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]