SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 160488.PP_0075 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_0075
Domain Number 1 Region: 424-517
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.1e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_0075
Sequence length 521
Comment (Pseudomonas putida KT2440)
Sequence
MHRLSLLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYALIAGLPAEYGLYAAIV
PVLIACLWGSSWYLICGPTAAISIVLYASISPLAVAGSADYITLVLLLTFLGGIFQLLLG
LLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMALPSQATALMTVQDLASHAGEV
DLPSLLLGLATVVIGAAFKLWRPRWPSLLISLILVSLLAWLLPGFFGHVPRVAAFTGQLP
PFSPLPLLDMELMLRLLPSAVAVGMLGLVTSLSIARSLSARSEQLIDPDQEIRAQGLSNI
AGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFSALWVALFAVTGAGLIAHLPIPAMAGS
ILLICWGLVDHRGIRALFRVSRSEFLVMALTAAATLLLELQTAIYAGVLASLFFYLKRTS
RPRIQQSREGDADVLRVGGSIFFGAAHYLQVRLQRCQGPHVVIDARQVNFIDYSGVDMLH
REARRLRRLGGSLTLHRARPQVIEELQKLEGVELCPIRFEE
Download sequence
Identical sequences Q88RQ4
GO.8978 NP_742245.1.35174 WP_010951481.1.28295 WP_010951481.1.28475 WP_010951481.1.3142 WP_010951481.1.58218 WP_010951481.1.71439 WP_010951481.1.87606 gi|26986820|ref|NP_742245.1| 160488.PP_0075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]