SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 160488.PP_0200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_0200
Domain Number 1 Region: 25-201
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.15e-28
Family Clp protease, ClpP subunit 0.019
Further Details:      
 
Domain Number 2 Region: 374-440
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000144
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_0200
Sequence length 448
Comment (Pseudomonas putida KT2440)
Sequence
MIARCWRWLLLLLLLGITPGGQAAPGAVWVLNIDDAIGPASADYLVRSLGQAQAQGAQLV
VIRMDTPGGLDSAMRQMIKAILSSTVPVASYVAPSGARAASAGTYILYASHIAAMAPGTN
LGAATPVRIGGAPGTPSDDKAKGGDDETLARKQVNDAAAYIRGLAQMRGRNADWAEKAVR
EAVSLSASEALRLNVIDQVADDLPDLLRKLDGKTLQVAGQPRQLQTAGASVVEHLPDWRT
RFLAVITNPSVALILIMIGVYGLLFEFMNPGSAVGGVVGGICLLLALYALQLLPVSFAGV
ALILLGITFMIAEAFLPSFGVVGFGGIVAFVVGALILIDTDAPGFGIPLALIGTLALLSA
LLIGGVLGMALKARQRALVSGDAGLVGSLVTVTQVMASDPFCGVVLAQGEQWQVQCATPL
QTGQNVRVTARHGVMLEVSAAAPATQGE
Download sequence
Identical sequences Q88RD2
NP_742369.1.35174 WP_010951584.1.28295 WP_010951584.1.28475 WP_010951584.1.3142 WP_010951584.1.58218 WP_010951584.1.71439 WP_010951584.1.87606 gi|26986944|ref|NP_742369.1| 160488.PP_0200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]