SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160488.PP_0424 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_0424
Domain Number 1 Region: 13-140
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-33
Family cAMP-binding domain 0.00000255
Further Details:      
 
Domain Number 2 Region: 143-211
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000671
Family CAP C-terminal domain-like 0.0000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_0424
Sequence length 214
Comment (Pseudomonas putida KT2440)
Sequence
MVASALPAKIKNIDKLLVHCQRRRYTAKSNIICAGDRAETLSFIIKGSVTILIEDDDGHE
MIIAYLNHGDFFGELGLFEPVDGEQQRSAWVRAKTECEVAEISYEKFRELARQDPEILYA
LGSQMAQRLRNTTRKVGDLAFFDVTGRVARCLLELCKQPDAMTHPDGMQIKITRQEIGRI
VGCSREMVGRVLKDLEERSLVQVKGKTMVVHGTR
Download sequence
Identical sequences A0A179S917 Q88QR4
gi|26987165|ref|NP_742590.1| 160488.PP_0424 NP_742590.1.35174 WP_010951759.1.28295 WP_010951759.1.28475 WP_010951759.1.3142 WP_010951759.1.41 WP_010951759.1.58218 WP_010951759.1.675 WP_010951759.1.71439 WP_010951759.1.87606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]